The short version of hGH fragment fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-09-08 and is reviewed periodically as new material appears.
Interest in AOD-9604 arose from attempts to separate metabolic effects from growth effects attributed to hGH. Early work explored whether the fragment could influence lipolysis or fat oxidation without promoting growth. Those questions remain partly unresolved because human data are limited and results have varied across studies. The peptide is not a hormone replacement for hGH and is not equivalent to hGH in clinical use. Its research history includes both laboratory studies and commercial marketing claims that are not the same as regulatory approval.
AOD-9604 is a synthetic peptide whose structure corresponds to a C-terminal segment of human growth hormone. It is often described as hGH fragment 176-191, a 16-amino-acid sequence. The peptide was designed to isolate a region of hGH associated with fat metabolism while avoiding the full hormone's growth-promoting actions. Laboratory and commercial materials typically present it as a lyophilized powder for research use. Its identity is defined by amino acid sequence, not by a single brand.
Commercial AOD-9604 may vary in purity, counterion content, and residual moisture. Certificates of analysis often report HPLC purity, mass confirmation, and appearance, but testing methods differ between suppliers. Independent verification is sometimes used because labeled content may not match actual peptide amount. Stability under different pH and temperature conditions is not fully standardized across studies. Researchers generally treat lyophilized material as the reference form for weighing and reconstitution. Moisture content can affect accurate mass measurement.
AOD-9604 is typically supplied as a lyophilized white to off-white powder. In this form, it is relatively stable when kept cool, dry, and protected from light. Common storage recommendations place it at −20 °C or below for long-term retention. Reconstituted solutions are less stable and are often kept at 2–8 °C for short periods. Freeze-thaw cycles should be minimized because they can promote aggregation or loss of peptide content. Vials are usually sealed under inert gas to reduce oxidation.
Identity and purity are commonly checked with reversed-phase high-performance liquid chromatography and mass spectrometry. RP-HPLC separates the peptide from related impurities and can estimate purity by peak area. Mass spectrometry confirms molecular mass and helps detect sequence variants or truncations. Some laboratories use amino acid analysis or peptide mapping for additional characterization. No single method proves biological activity; these techniques establish chemical identity and purity only. They also require suitable reference standards for confident comparison.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Based on the C-terminal region of human growth hormone. |
| Amino acid length | 16 residues | Often described as hGH fragment 176-191. |
| Appearance | Lyophilized powder | Typically white to off-white; exact appearance depends on grade. |
| Solubility | Soluble in water | Aqueous solubility depends on pH, ionic strength, and preparation. |
| Typical storage | -20 °C or lower | Lyophilized peptide is usually kept cold and dry; solutions may require freezing. |
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography and mass spectrometry. Reversed-phase HPLC separates the peptide from related impurities and can estimate purity by ultraviolet absorbance, while mass spectrometry confirms the molecular mass and detects modifications. Peptide mapping, amino acid analysis, and disulfide mapping may be used when the sequence or disulfide arrangement must be verified. Because AOD9604 contains cysteine residues, oxidation and disulfide isomers are possible quality concerns in synthetic batches.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.
Regulatory treatment of AOD-9604 has varied. In sports anti-doping, the peptide became widely discussed during a 2013 investigation into an Australian professional sports club. Authorities at the time debated whether it fell under prohibitions on growth hormone and related substances. Later clarifications and updated lists have addressed the compound in different ways. Anyone seeking current status should consult the latest applicable rules, and commercial supply for human use is not authorized in major markets.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Among the actinides, thorium and uranium are the easiest to isolate. Thorium is extracted mostly from monazite: thorium pyrophosphate (ThP2O7) is reacted with nitric acid, and the produced thorium nitrate treated with tributyl phosphate. Rare-earth impurities are separated by increasing the pH in sulfate solution. In another extraction method, monazite is decomposed with a 45% aqueous solution of sodium hydroxide at 140 °C. Mixed metal hydroxides are extracted first, filtered at 80 °C, washed with water and dissolved with concentrated hydrochloric acid. Next, the acidic solution is neutralized with hydroxides to pH = 5.8 that results in precipitation of thorium hydroxide (Th(OH)4) contaminated with ~3% of rare-earth hydroxides; the rest of rare-earth hydroxides remains in solution. Thorium hydroxide is dissolved in an inorganic acid and then purified from the rare earth elements. An efficient method is the dissolution of thorium hydroxide in nitric acid, because the resulting solution can be purified by extraction with organic solvents:
== Side effects == Frequently reported side effects include: nausea, heartburn, weight gain, and bloating. The medication is also a major cause of medication-induced hypoglycemia. The risk is greater than with other sulfonylureas.
The final step in gluconeogenesis, the formation of glucose, occurs in the lumen of the endoplasmic reticulum, where glucose-6-phosphate is hydrolyzed by glucose-6-phosphatase to produce glucose and release an inorganic phosphate. Like two steps prior, this step is not a simple reversal of glycolysis, in which hexokinase catalyzes the conversion of glucose and ATP into G6P and ADP. Glucose is shuttled into the cytoplasm by glucose transporters located in the endoplasmic reticulum's membrane.
The proteome can be used in order to comparatively analyze different cancer cell lines. Proteomic studies have been used in order to identify the likelihood of metastasis in bladder cancer cell lines KK47 and YTS1 and were found to have 36 unregulated and 74 down regulated proteins. The differences in protein expression can help identify novel cancer signaling mechanisms. Biomarkers of cancer have been found by mass spectrometry based proteomic analyses. The use of proteomics or the study of the proteome is a step forward in personalized medicine to tailor drug cocktails to the patient's specific proteomic and genomic profile. The analysis of ovarian cancer cell lines showed that putative biomarkers for ovarian cancer include "α-enolase (ENOA), elongation factor Tu, mitochondrial (EFTU), glyceraldehyde-3-phosphate dehydrogenase (G3P), stress-70 protein, mitochondrial (GRP75), apolipoprotein A-1 (APOA1), peroxiredoxin (PRDX2) and annexin A (ANXA)". Comparative proteomic analyses of 11 cell lines demonstrated the similarity between the metabolic processes of each cell line; 11,731 proteins were completely identified from this study. Housekeeping proteins tend to show greater variability between cell lines. Resistance to certain cancer drugs is still not well understood. Proteomic analysis has been used in order to identify proteins that may have anti-cancer drug properties, specifically for the colon cancer drug irinotecan. Studies of adenocarcinoma cell line LoVo demonstrated that 8 proteins were unregulated and 7 proteins were down-regulated.
Sources: en.wikipedia.org
In the chemical industry, carbon dioxide is mainly consumed as an ingredient in the production of urea, with a smaller fraction being used to produce methanol and a range of other products. Some carboxylic acid derivatives such as sodium salicylate are prepared using CO2 by the Kolbe–Schmitt reaction. Captured CO2 could be to produce methanol or electrofuels. To be carbon-neutral, the CO2 would need to come from bioenergy production or direct air capture.
=== With insulin === Carbohydrate counting may be used with either a fixed insulin dosage or with a more flexible insulin dosage. Carb counting for fixed insulin dosage is done in the same manner as carbohydrate counting without insulin. The only difference is that insulin is administered with the meal. With more flexible insulin dosage, the insulin is administered in regards to the amount of carbohydrate consumed. The insulin amount will vary based on the amount of carbohydrates consumed.
=== Equivalents in prokaryotes === The bacterial cytoskeleton contains proteins that are highly similar to actin monomers and polymers. The bacterial protein MreB polymerizes into thin non-helical filaments and occasionally into helical structures similar to F-actin. Furthermore, its crystalline structure is very similar to that of G-actin (in terms of its three-dimensional conformation), there are even similarities between the MreB protofilaments and F-actin. The bacterial cytoskeleton also contains the FtsZ proteins, which are similar to tubulin. Bacteria therefore possess a cytoskeleton with homologous elements to actin (for example, MreB, AlfA, ParM, FtsA, and MamK), even though the amino acid sequence of these proteins diverges from that present in animal cells. However, such proteins have a high degree of structural similarity to eukaryotic actin. The highly dynamic microfilaments formed by the aggregation of MreB and ParM are essential to cell viability and they are involved in cell morphogenesis, chromosome segregation, and cell polarity. ParM is an actin homologue that is coded in a plasmid and it is involved in the regulation of plasmid DNA. ParMs from different bacterial plasmids can form astonishingly diverse helical structures comprising two or four strands to maintain faithful plasmid inheritance. In archaea the homologue Ta0583 is even more similar to the eukaryotic actins.
===== Reverse transcription ===== One way of doing this is to develop nucleotide or nucleoside analogues that look like the building blocks of RNA or DNA, but deactivate the enzymes that synthesize the RNA or DNA once the analogue is incorporated. This approach is more commonly associated with the inhibition of reverse transcriptase (RNA to DNA) than with "normal" transcriptase (DNA to RNA). The first successful antiviral, aciclovir, is a nucleoside analogue, and is effective against herpesvirus infections. The first antiviral drug to be approved for treating HIV, zidovudine (AZT), is also a nucleoside analogue. An improved knowledge of the action of reverse transcriptase has led to better nucleoside analogues to treat HIV infections. One of these drugs, lamivudine, has been approved to treat hepatitis B, which uses reverse transcriptase as part of its replication process. Researchers have gone further and developed inhibitors that do not look like nucleosides, but can still block reverse transcriptase. Another target being considered for HIV antivirals include RNase H—which is a component of reverse transcriptase that splits the synthesized DNA from the original viral RNA.
Sources: en.wikipedia.org
It is a synthetic peptide based on a C-terminal fragment of human growth hormone. It is commonly referred to as hGH fragment 176-191 and is studied for metabolic effects rather than growth effects.
No. It represents only a short portion of the hGH sequence and lacks the full hormone's structure. As a result, its biological activity and regulatory status differ from those of prescription hGH.
The exact peptide is not typically described as a circulating hormone; it is a synthetic construct based on a natural sequence. Fragments of hGH can exist in laboratory or metabolic contexts, but AOD-9604 itself is manufactured for research.
Lyophilized powder is commonly stored at −20 °C or below, protected from light and moisture. Reconstituted solutions are typically kept refrigerated and used within a limited period.