lipogenesis is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-04-06. Numbers and descriptions here follow the published literature rather than marketing material.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 has been investigated primarily as a potential treatment for obesity and related metabolic conditions. Early laboratory work examined its effects on fat cells, and later studies moved into animal models and human clinical trials. Some trials reportedly reached Phase II, but the program did not lead to an approved medicine. Published summaries often note that weight-loss results were modest or inconsistent. The full trial data are not all publicly available in detail.
Clinical development of AOD-9604 included trials in people with obesity. Reports from early-phase and mid-phase studies described modest or inconsistent changes in body weight. A phase IIb program did not meet its primary endpoint, and the compound was not approved for medical use. Differences in formulation, delivery route, and participant characteristics may explain some of the variation. Later investigations explored whether the peptide might have effects in other tissues, including cartilage.
Regulatory treatment of AOD-9604 is shaped by its classification as a peptide hormone. The World Anti-Doping Agency lists it as a prohibited substance, and many national anti-doping organizations adopt that list. It does not hold approval as a prescription medicine in the United States, the European Union, or other major markets. Products sold online are frequently labeled for research use only and may not undergo independent quality testing. Import and possession rules differ by country, so legal status depends on local law.
Proposed mechanisms for AOD-9604 focus on fat cells. Laboratory studies suggest the peptide can increase lipolysis, the breakdown of stored fat, and reduce lipogenesis, the formation of new fat. Unlike full human growth hormone, it does not appear to stimulate substantial IGF-1 production in the studies reported so far. Some evidence points to beta-adrenergic signaling, but the precise receptor targets and downstream pathways remain unresolved. The fragment is not thought to act through the classical growth hormone receptor.
| Property | Value | Notes |
|---|---|---|
| Primary research area | Obesity and metabolic regulation | Studied in cell, animal, and human models |
| Highest reported trial phase | Phase II | Public summaries describe mixed results |
| Common route in trials | Subcutaneous injection | Typical for peptide therapeutics |
| Regulatory example | 2013 Australian anti-doping review | Classification was debated at the time |
| Approval status | Not approved as a human medicine | Status can change by jurisdiction |
Interest in AOD-9604 arose from attempts to separate metabolic effects from growth effects attributed to hGH. Early work explored whether the fragment could influence lipolysis or fat oxidation without promoting growth. Those questions remain partly unresolved because human data are limited and results have varied across studies. The peptide is not a hormone replacement for hGH and is not equivalent to hGH in clinical use. Its research history includes both laboratory studies and commercial marketing claims that are not the same as regulatory approval.
AOD-9604 is a synthetic peptide whose structure corresponds to a C-terminal segment of human growth hormone. It is often described as hGH fragment 176-191, a 16-amino-acid sequence. The peptide was designed to isolate a region of hGH associated with fat metabolism while avoiding the full hormone's growth-promoting actions. Laboratory and commercial materials typically present it as a lyophilized powder for research use. Its identity is defined by amino acid sequence, not by a single brand.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography and mass spectrometry. Reversed-phase HPLC separates the peptide from related impurities and can estimate purity by ultraviolet absorbance, while mass spectrometry confirms the molecular mass and detects modifications. Peptide mapping, amino acid analysis, and disulfide mapping may be used when the sequence or disulfide arrangement must be verified. Because AOD9604 contains cysteine residues, oxidation and disulfide isomers are possible quality concerns in synthetic batches.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
In the second step, the liquid mixtures of cells, matrix, and nutrients known as bioinks are placed in a printer cartridge and deposited using the patients' medical scans. When a bioprinted pre-tissue is transferred to an incubator, this cell-based pre-tissue matures into a tissue. 3D bioprinting for fabricating biological constructs typically involves dispensing cells onto a biocompatible scaffold using a successive layer-by-layer approach to generate tissue-like three-dimensional structures. Artificial organs such as livers and kidneys made by 3D bioprinting have been shown to lack crucial elements that affect the body such as working blood vessels, tubules for collecting urine, and the growth of billions of cells required for these organs. Without these components the body has no way to get the essential nutrients and oxygen deep within their interiors. Given that every tissue in the body is naturally composed of different cell types, many technologies for printing these cells vary in their ability to ensure stability and viability of the cells during the manufacturing process. Some of the methods that are used for 3D bioprinting of cells are photolithography, magnetic 3D bioprinting, stereolithography, and direct cell extrusion.
The rearrangements of heavy-chains are different from the light chains because DNA undergoes rearrangements of V-D-J gene segments in the heavy chains. These reorganizations of gene segments produce gene sequence from 5 prime to 3 prime ends such as a short leader exon, an intron, a joined VDJ segment, a second intron and several gene segments. The final product of the rearrangement is transcribed when RNA polymerase
81. ArXiv [Preprint]. 2026 Jul 29:arXiv:2605.17186v2. Operator splitting for exploiting linear-rate closure in solving infinite ODE hierarchies. Chang JC. We introduce an operator-splitting method for infinite hierarchies of linear ordinary differential equations (ODEs) indexed by nonnegative integers. When the coupling coefficients depend linearly on the count index, an exact transformation closes the equations on finite count-index windows without an upper-boundary value. For more general hierarchies, Strang splitting applies the linear-rate closure during the linear-rate substeps and a conventional capped solver to the remainder. We derive the closure from generating functions and the method of characteristics and extend it to multi-indexed systems. The derivation requires neither positivity nor mass conservation, so it applies to a wider class of systems than the examplar stochastic models presented here. We discuss branching processes, stochastic predator-prey dynamics, the Schlögl chemical kinetics model, and a telegraph model for gene expression. Through numerical experiments and computational cost analyses we demonstrate that our operator splitting method is typically advantageous for solving large scale systems in terms of memory usage and computational time, while retaining accuracy competitive with finite state projection (FSP) methods. PMCID: PMC13618430
90. ArXiv [Preprint]. 2026 Jul 29:arXiv:2605.17186v2. Operator splitting for exploiting linear-rate closure in solving infinite ODE hierarchies. Chang JC. We introduce an operator-splitting method for infinite hierarchies of linear ordinary differential equations (ODEs) indexed by nonnegative integers. When the coupling coefficients depend linearly on the count index, an exact transformation closes the equations on finite count-index windows without an upper-boundary value. For more general hierarchies, Strang splitting applies the linear-rate closure during the linear-rate substeps and a conventional capped solver to the remainder. We derive the closure from generating functions and the method of characteristics and extend it to multi-indexed systems. The derivation requires neither positivity nor mass conservation, so it applies to a wider class of systems than the examplar stochastic models presented here. We discuss branching processes, stochastic predator-prey dynamics, the Schlögl chemical kinetics model, and a telegraph model for gene expression. Through numerical experiments and computational cost analyses we demonstrate that our operator splitting method is typically advantageous for solving large scale systems in terms of memory usage and computational time, while retaining accuracy competitive with finite state projection (FSP) methods. PMCID: PMC13618430
Sources: en.wikipedia.org
Cardiac alpha actin is a 42.0 kDa protein composed of 377 amino acids. Cardiac alpha actin is a filamentous protein extending from a complex mesh with cardiac alpha-actinin (ACTN2) at Z-lines towards the center of the sarcomere. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The atomic structure of monomeric actin was solved by Kabsch et al., and closely thereafter this same group published the structure of the actin filament. Actins are highly conserved proteins; the alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Cardiac (ACTC1) and skeletal (ACTA1) alpha actins differ by only four amino acids (Asp4Glu, Glu5Asp, Leu301Met, Ser360Thr; cardiac/skeletal). The actin monomer has two asymmetric domains; the larger inner domain comprised by sub-domains 3 and 4, and the smaller outer domain by sub-domains 1 and 2. Both the amino and carboxy-termini lie in sub-domain 1 of the outer domain.
The diagnosis of MADD needs to be considered in patients who have exercise induced myalgia, cramps and sometimes weakness. A mildly elevated creatine kinase may also occur. Exclusion of other muscular diseases such as McArdle's Disease and carnitine cycle abnormalities should occur. MADD may be identified if there is a lack of ammonia rise after forearm exercise testing. The diagnosis may then be confirmed with genetic testing.
July 28 – August 4: 2018 Senior League Baseball World Series in Easley at Easley Recreation Complex The Pariba Little League (Caribbean) defeated the Naamans Little League (East), 7–2, in the final. July 29 – August 5: 2018 Little League Intermediate (50/70) Baseball World Series in Livermore at Max Baer Park The West Seoul LL (Asia-Pacific) defeated the Livermore/Granada LL (Host), 10–0, in the final. August 12 – 19: 2018 Junior League World Series in Taylor at Heritage Park The Shing-Ming Junior LL (Asia-Pacific) defeated the Lufkin LL (Southwest), 2–0, in the final. August 16 – 26: 2018 Little League World Series in South Williamsport at both the Little League Volunteer Stadium and the Howard J. Lamade Stadium The Honolulu LL (West) defeated the South Seoul LL (Asia-Pacific and Middle East), 3–0, in the final.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Abdurozik Savriqul Muhammadroziqi (Tajik: Абдурозиқ Савриқул Муҳаммадрозиқӣ, [æbdurɑˈzɯq sævrɯˈqul muˌɦæmːædrɑzɯˈqiː], born 23 September 2003), known professionally as Abdu Rozik, is a Tajikistani playback singer and social media influencer based in Dubai, UAE. In 2022, he participated in Bigg Boss 16 and later in Laughter Chefs – Unlimited Entertainment 2. As a child, Rozik was diagnosed with dwarfism, a growth hormone deficiency which could be cured with appropriate medical treatment. However, his family could not afford to have him treated, leading to his stunted growth. Due to his family's poverty, Rozik was often out of school. He sang for tips in markets and on streets of Panjakent in Tajikistan; along with his family, Rozik also had a beloved pet cat named Renzo, a British Shorthair, who brought him a lot of joy during difficult times.
Sources: en.wikipedia.org
The HIE-ISOLDE project introduced a network of High Energy Beam Transfer (HEBT) beamlines to the ISOLDE facility. The common section beamline, XT00, joins to three bending beamlines (XT01, XT02, XT03) leading to different experiment setups. The three identical beamlines are independent of each other, for example, if the first XT01 dipole magnet is off, the beam will continue to the XT02 and XT03. They all bend the beam by 90 degrees and focus it using two dipole magnets and a doublet-quadrupole. The XT01 beamline leads to Miniball, the XT02 beamline leads to the ISS, and the XT03 beamline leads to movable setups, such as the SEC scattering chamber. Offline 2 was recently installed as a mass separator beamline at ISOLDE, with the purpose of satisfying the increased demands on the original offline facility, Offline 1. The facility includes the beamline enclosed in a Faraday cage as well as a laser laboratory and control station. The offline facility is designed for target test studies, and upgraded to include potential for the production and study of molecular ion beams.
Site-specific recombination makes use of phage integrases instead of restriction enzymes, eliminating the need for having restriction sites in the DNA fragments. Instead, integrases make use of unique attachment (att) sites, and catalyse DNA rearrangement between the target fragment and the destination vector. The Invitrogen Gateway cloning system was invented in the late 1990s and uses two proprietary enzyme mixtures, BP clonase and LR clonase. The BP clonase mix catalyses the recombination between attB and attP sites, generating hybrid attL and attR sites, while the LR clonase mix catalyse the recombination of attL and attR sites to give attB and attP sites. As each enzyme mix recognises only specific att sites, recombination is highly specific and the fragments can be assembled in the desired sequence. Vector design and assembly Because Gateway cloning is a proprietary technology, all Gateway reactions must be carried out with the Gateway kit that is provided by the manufacturer. The reaction can be summarised into two steps. The first step involves assembling the entry clones containing the DNA fragment of interest, while the second step involves inserting this fragment of interest into the destination clone.
11-Deoxycortisol, also known as cortodoxone (INN), cortexolone as well as 17α,21-dihydroxyprogesterone or 17α,21-dihydroxypregn-4-ene-3,20-dione, is an endogenous glucocorticoid steroid hormone, and a metabolic intermediate toward cortisol. The compound was first described by Tadeusz Reichstein in 1938 as Substance S, thus has also been referred to as Reichstein's Substance S or Compound S. 11-Deoxycortisol acts as a glucocorticoid, though is less potent than cortisol. 11-Deoxycortisol is synthesized from 17α-hydroxyprogesterone by 21-hydroxylase and is converted to cortisol by 11β-hydroxylase.
In Taiwan, the Taiwan Transportation Safety Board (TTSB) is the independent government agency that is responsible for major transportation accident investigations. TTSB's predecessor was ASC, which was established in 1998. TTSB is under the administration of the Executive Yuan and independent from Civil Aviation Administration. The TTSB consisted of five to seven board members, including a chairman and a vice chairman, appointed by the Premier. The managing director of TTSB manages the day-to-day function of the organization, including accident investigations. In the United Kingdom, the agency responsible for investigation of civilian air crashes is the Air Accidents Investigation Branch (AAIB) of the Department for Transport. Its purpose is to establish the circumstances and causes of the accident and to make recommendations for their future avoidance.
Sources: en.wikipedia.org
No major medicines regulator appears to have approved AOD-9604 for human therapeutic use. It has been studied in clinical trials, but those programs did not result in a marketed drug.
It became prominent during a 2013 Australian sports investigation that examined whether it was a prohibited growth-hormone-related substance. Subsequent interpretations and list updates have varied, so current rules should be checked directly.
Published summaries generally report limited or inconsistent weight-loss effects, and complete trial data are not widely available. The studies were not sufficient to establish it as an effective obesity treatment.
No. Major drug regulators have not approved AOD-9604 for weight loss or any other therapeutic indication. It remains an investigational compound studied in research settings.